Protein Info for ABZR87_RS19615 in Ralstonia sp. UNC404CL21Col

Annotation: spermidine N1-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF13302: Acetyltransf_3" amino acids 9 to 144 (136 residues), 82.9 bits, see alignment E=1.1e-26 PF13420: Acetyltransf_4" amino acids 11 to 159 (149 residues), 31 bits, see alignment E=7.6e-11 PF13523: Acetyltransf_8" amino acids 17 to 148 (132 residues), 30.4 bits, see alignment E=8.3e-11 PF00583: Acetyltransf_1" amino acids 36 to 143 (108 residues), 59 bits, see alignment E=1.7e-19 PF13508: Acetyltransf_7" amino acids 60 to 145 (86 residues), 32.9 bits, see alignment E=2.1e-11

Best Hits

Swiss-Prot: 66% identical to ATDA_ECO57: Spermidine N(1)-acetyltransferase (speG) from Escherichia coli O157:H7

KEGG orthology group: K00657, diamine N-acetyltransferase [EC: 2.3.1.57] (inferred from 98% identity to rpf:Rpic12D_4374)

MetaCyc: 66% identical to spermidine N-acetyltransferase (Escherichia coli K-12 substr. MG1655)
Diamine N-acetyltransferase. [EC: 2.3.1.57]; 2.3.1.57 [EC: 2.3.1.57]; 2.3.1.57 [EC: 2.3.1.57]

Predicted SEED Role

"Spermidine N1-acetyltransferase (EC 2.3.1.57)" in subsystem Polyamine Metabolism (EC 2.3.1.57)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>ABZR87_RS19615 spermidine N1-acetyltransferase (Ralstonia sp. UNC404CL21Col)
MVIEKSRDLCLRPLERNDLRFVHELNNDAKIMRYWFEEPYETFTELSQLYDRHVHDQRER
RFICENDAGEAVGLVELMELNYIHRRGEFQIIIAPGWQGHGYASTATRLAVDYAFMVLNL
HKLYLVVDVVNERAIHVYEKCGFQREGELIEEFFSNGAYHNALRMCVFQRDYVKSIRGAT