Protein Info for ABZR87_RS19555 in Ralstonia sp. UNC404CL21Col

Annotation: type II secretion system F family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 132 to 138 (7 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 291 to 314 (24 residues), see Phobius details PF00482: T2SSF" amino acids 185 to 310 (126 residues), 53 bits, see alignment E=1.7e-18

Best Hits

KEGG orthology group: K12511, tight adherence protein C (inferred from 92% identity to rpf:Rpic12D_4362)

Predicted SEED Role

"Type II/IV secretion system protein TadC, associated with Flp pilus assembly" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>ABZR87_RS19555 type II secretion system F family protein (Ralstonia sp. UNC404CL21Col)
MDETLITLSLTAAAAGVLVFGGLALRATLTRYRSARKLDTALSDIRATAANPAATTAAPA
VPPAVKARPHGTREAQQLQQQIAKVGQRWIDTSLGQRIVTEEDRKLLEECGYYGEHARTV
FGGTRIVLPPVLAVVGALNATSILFVFVWGFVGFALGYLGPKWLLGRRKESRRRRVDDEL
PVMVDMLRLLQGVGLSIDQSLQVIANEFHSMLPVLAGEFGRANQQFASGRPREQTLLRIA
RLFDNEDLKGLITLLTQVDRFGGAVQEPLRQFGGRLQENRRARLKERVGKLTVKMTMIMV
MTLLPALLIITAGPGFMNVMRSLQHTGGN