Protein Info for ABZR87_RS19490 in Ralstonia sp. UNC404CL21Col

Annotation: bifunctional diguanylate cyclase/phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 695 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 45 to 62 (18 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 268 to 426 (159 residues), 128.9 bits, see alignment E=8e-42 PF00990: GGDEF" amino acids 268 to 423 (156 residues), 145.5 bits, see alignment E=1.3e-46 PF00563: EAL" amino acids 444 to 680 (237 residues), 265.7 bits, see alignment E=3.4e-83

Best Hits

KEGG orthology group: None (inferred from 95% identity to rpi:Rpic_4239)

Predicted SEED Role

"FIG00978002: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (695 amino acids)

>ABZR87_RS19490 bifunctional diguanylate cyclase/phosphodiesterase (Ralstonia sp. UNC404CL21Col)
MHNDFHIALLLFAWVSTGLTTFAALDAATRLPGGSTIAKRRNWRIACAAILGIGLWSGLW
LGQLGLHRQVGTPISAPIAATLMTALAASLAVFSIALPDSSPANGAQVPQRRSIAMGAVA
LGIGLLTMELYLTRPWVHDDALSLRRTLLGWGGGTLVLGAGVCLAVCMAFHMPPAQRRAA
VGLRARAAAVLATTAVLSLVLWPCAAAWPADASMTQTVPVIMLSAGGVLIALGLHAVLMM
LETRVDSAQAHLEASLARVANQTPRPQFHDTLTGLPNRLHLREALEAAILSSTRRGRPFA
LFYLDLDNFGQINDQYGRNAGDRVLQIIAERLRQTIRGEDTVARLGGDEFGILVEGLALP
EAAATIGDKLLFRLRESVEVEGRRLRATASIGVVVHPHNGATADALLEHADTAMFDCKQS
TGNAYRFFEPRLNTTAHRVLQIQRALSHAALNGQLSVYYQPKYDARTQAMTGAEALLRWN
HPELGPVSPAEFIPLAERTGTIVELGDWVVEEVCRQIMHWDAIGMPPQRIAVNLSPRQFQ
QPDLVQRLSQILHRYQVAAHRLMFEITETAAMRDAGQSIAAIRQIQSLGFEVAIDDFGTG
YSSLSYLQRFRAQQIKIDRAFVSALDDNPAEAAAIIRAICAMAHSLDMTVVAEGVETEAQ
MQALVSLQCDQVQGYLLARPLPAKDFQGLLGLQYA