Protein Info for ABZR87_RS19475 in Ralstonia sp. UNC404CL21Col

Annotation: PAS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 287 to 391 (105 residues), 40.8 bits, see alignment E=1.1e-14 PF08447: PAS_3" amino acids 312 to 397 (86 residues), 67.6 bits, see alignment E=4.8e-23

Best Hits

KEGG orthology group: None (inferred from 87% identity to rpf:Rpic12D_4346)

Predicted SEED Role

"FIG00974896: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (475 amino acids)

>ABZR87_RS19475 PAS domain-containing protein (Ralstonia sp. UNC404CL21Col)
MDEVLIAHLVNTLAHASLPALLPFVVACGAGSLLLRLLDDLRSATASRTRVPLVMTALFA
AIGLWAVPLLPLLARWPLHEDTAVLVMTLASFCWSLAVAALWCVLGGRAGMVRALSLGVL
LSVSGPVAVLLLAGVTSFSTTAWEDAGLLAIVIVLSAVACAAALQFALSARSGATGVAVR
RPGVSLFVSVLFGTALTADAVYTASLAGSFSTFSAMPANAPAGLQVLLVVGAVATVLAAL
LLGYRDRATGDTAAAIAAREIRLRKETVQALNDLEQSYRRREAELVARHQLLLDGADVGL
WEFDLVTRAAQFSTRFAAMLGYTLKEIGPSTSEYLRLVHPDDLPMVLNRIQAHVDGNSPA
YVAEFRMRHKDGNYRQMAAHGVAVRDAGGNAVRMAGSHIEMAVKVVKVAEAEVAAPASST
VAQAPETLRRHGLWESWSPIDSSAAEAVPAQSAPTAAPAPASGGALPSINPNALR