Protein Info for ABZR87_RS19405 in Ralstonia sp. UNC404CL21Col

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 45 to 373 (329 residues), 268.9 bits, see alignment E=2.5e-84 PF16576: HlyD_D23" amino acids 71 to 293 (223 residues), 56.5 bits, see alignment E=3.8e-19 PF13533: Biotin_lipoyl_2" amino acids 71 to 118 (48 residues), 49.7 bits, see alignment 3.6e-17 PF13437: HlyD_3" amino acids 181 to 290 (110 residues), 33.1 bits, see alignment E=1.2e-11

Best Hits

KEGG orthology group: None (inferred from 98% identity to rpi:Rpic_4225)

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>ABZR87_RS19405 efflux RND transporter periplasmic adaptor subunit (Ralstonia sp. UNC404CL21Col)
MSLSKRTLAISVAAVLGVAAVGTYGLVSSAGASQQPAAAPAATPVDVAPVLAKNVSEWDE
FSGRIEAVQRVEVRPLVSGTVTAVHFKDGSIVKKGDALFTIDPRPYAAEVARTQAALTAA
KSRVAYTTSELDRAQKLVADNAIARREFEEKENAAREAQANLQGAAAALEAAKLNLEYTH
IVAPVAGRVSRAEITVGNVVSAGGAAPVLTTLVSVSPMYVAFDADEQSYLRYSEKAAQGA
KTPVYIGLANEDGYTREGVIQSVDNRLDVRSGTIRVRATLDNADGRLTPGLYARVRMSTG
APHDAILISDKAIGTDQDKKFVLVVDAANKTSYRPVVLGASIDGLRVVKSGLKAGERIVV
NGIQRVRPGDAVAPNTVTMDSLVTKRVVLPGAQPEAPAAPAEAKADTSAAPAAKAETKPA
NAKTAANAQRLPADRA