Protein Info for ABZR87_RS19355 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 47 to 70 (24 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 163 to 187 (25 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details amino acids 337 to 363 (27 residues), see Phobius details amino acids 375 to 394 (20 residues), see Phobius details amino acids 402 to 422 (21 residues), see Phobius details PF07690: MFS_1" amino acids 46 to 334 (289 residues), 142.2 bits, see alignment E=3e-45 amino acids 288 to 426 (139 residues), 40.8 bits, see alignment E=2.1e-14 PF00083: Sugar_tr" amino acids 71 to 231 (161 residues), 70.9 bits, see alignment E=1.6e-23 amino acids 346 to 433 (88 residues), 25.4 bits, see alignment E=1e-09

Best Hits

KEGG orthology group: None (inferred from 89% identity to rsl:RPSI07_mp1176)

Predicted SEED Role

"Sialic acid transporter (permease) NanT" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>ABZR87_RS19355 MFS transporter (Ralstonia sp. UNC404CL21Col)
MTTEATVARAPAEPDASAAANSGGLFRWYGEISAQERRTFWSCKVGYALDAMDTQILSFV
IPTLIGVWGLSKADAGLIGTCTLLASAAGGWVAGILSDRIGRVRALQITILWFAVFTFLC
GLAQNYEQLLIARTLMGFGFGGEWTAGAVLIGEAIRAQDRGKAVGMVQAGWALGWGASAL
LYAWFFSVMPPETAWRALFLVGIVPAVFVFFLRRLVKEPEVFQEAKSQASERTSFFAIFS
PRLLSTTLRAAVLTTGAQGGYYAITTWLPTFLKTERHLTVLGTGGYLAVVIIGSYIGYLT
SAVLTDRLGRKRNFILFAVGSMVVALAYTHLEVTDSMMLLLGLPLGFFASGIFAGMGAFL
TELFPTSVRGSGQGFCYNVGRAVGACFPFLIGQVSAHSSLGHAIGIFAAGAYGLLIVAAL
TLPETRGRELESI