Protein Info for ABZR87_RS19350 in Ralstonia sp. UNC404CL21Col

Annotation: putative hydro-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF07286: D-Glu_cyclase" amino acids 126 to 268 (143 residues), 221.2 bits, see alignment E=2.4e-70

Best Hits

Swiss-Prot: 64% identical to Y6345_CUPTR: Putative hydro-lyase RALTA_B1245 (RALTA_B1245) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: None (inferred from 85% identity to rsl:RPSI07_mp1177)

Predicted SEED Role

"hypothetical protein possibly connected to lactam utilization and allophanate hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>ABZR87_RS19350 putative hydro-lyase (Ralstonia sp. UNC404CL21Col)
MPEQPAPAPAPARTGASVAYANPYSARLAARSGVLRGHTSGLCDGYVQANIVMLRDTWAN
EFLRFCQLNPKPCPLLDVTEPGVPVFRHLGQDVDVRRDVPRYRVYRNGELADEPADVEAL
WTDDMVAFAIGCSFSFEHALMEAGVPLRHIALSRNVAMYRTSIETVGTSRLAGKLVVSMR
PMTVPDAIRAIEITSRMPRAHGAPVHFGDPAAIGIADISQPDWGDAVPVQPGEVPVFWAC
GVTPQAVVQQARPELCITHAPGHMLITDLRTAALA