Protein Info for ABZR87_RS19270 in Ralstonia sp. UNC404CL21Col

Annotation: FHIPEP family type III secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 651 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 299 to 316 (18 residues), see Phobius details PF00771: FHIPEP" amino acids 20 to 422 (403 residues), 490.9 bits, see alignment E=3.3e-151 amino acids 430 to 639 (210 residues), 140.2 bits, see alignment E=4.7e-45

Best Hits

Predicted SEED Role

"Type III secretion inner membrane channel protein (LcrD,HrcV,EscV,SsaV)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (651 amino acids)

>ABZR87_RS19270 FHIPEP family type III secretion protein (Ralstonia sp. UNC404CL21Col)
MRWARLVNYDIAIAVFVVAVVALFVLPLPTVVLDGLISLNLAASIVLLCVSIYLPSALAF
SSFPAVLLFTTLFRLSLNIASCKLILLQANAGHVIDTFGKLVVGNNFVVGGVVFLVIAVV
QFIVIAKGSERVAEVGARFSLDAMPGKQMSIDADLRAGIITSDEAKRRREALEQESQLHG
AMDGAMKFVKGDAIAGIIIAVINILAGIAVGALMHGMSIGDALHRYAILTVGDGMASQIP
SLLVSIAAGIVTTRVATRDREARHLGQQIGAQITAHPRGMLMASGVLLAFLLVPGFPKWS
FLLLAIGTAAAAFLRMRQRRQAPPLDLLVLGPDARRVTAPEAGSPSEGIAAPIAVRLSED
LRGDIDLVALQTRLAEAKSRVQRRLGAVFPRVQLNWDATLPAHAYALLVQDVLAAEGTLP
ERDAISDNAMRAEDRLAAEVESLIERNAASLIGIQETQNLIQIMRREHGELVAELTRLVP
PQRITEVLRRLVQEGVSIRNLRAIFESLITWSPKEPEDVIGLVELVRVDLHRQITEQFCG
TSRVLDVVLFEQSLQERIEQAVVHTKQGSVLSLTRDAKQAITDQVVKILGGTRPLEKDRH
GRPLAVMVSLNCRRYVKTMLQPVFGDLPVLSYQEIDEAIELNTVGWVTNPA