Protein Info for ABZR87_RS19255 in Ralstonia sp. UNC404CL21Col

Annotation: type III secretion system export apparatus subunit SctR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 7 to 33 (27 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 162 to 186 (25 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details TIGR01102: type III secretion apparatus protein, YscR/HrcR family" amino acids 10 to 214 (205 residues), 252.6 bits, see alignment E=1.5e-79 PF00813: FliP" amino acids 14 to 214 (201 residues), 214.2 bits, see alignment E=8.2e-68

Best Hits

Swiss-Prot: 55% identical to HRCR_RALSO: Hypersensitivity response secretion protein HrcR (hrcR) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03226, type III secretion protein SctR (inferred from 76% identity to bch:Bcen2424_4840)

Predicted SEED Role

"Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>ABZR87_RS19255 type III secretion system export apparatus subunit SctR (Ralstonia sp. UNC404CL21Col)
MGNLPNPVAMIAVVAALGIAPFAALMVTSYTKLVVVFGLLRSALGIQQVPPNIVLNGIAL
ILTVFIMAPVGMEMVDNLRGRNFNLSSQMSVDDVIAILDAAQPPVKKFLQAHTLESERNF
FVKSATSIWPKERAAGLKNDDLTVLVPSFTLTELIKAFQVGFVLYIIFVVVDLVVANLLL
ALGMQMIAPTTISVPFKLLLFVMLDGWSVLVHGLVLSYR