Protein Info for ABZR87_RS19240 in Ralstonia sp. UNC404CL21Col

Annotation: molybdate ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details TIGR02141: molybdate ABC transporter, permease protein" amino acids 10 to 213 (204 residues), 249.5 bits, see alignment E=1.2e-78 PF00528: BPD_transp_1" amino acids 25 to 215 (191 residues), 74.4 bits, see alignment E=5e-25

Best Hits

Swiss-Prot: 47% identical to MODB_ECO57: Molybdenum transport system permease protein ModB (modB) from Escherichia coli O157:H7

KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 97% identity to rpf:Rpic12D_4332)

MetaCyc: 47% identical to molybdate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>ABZR87_RS19240 molybdate ABC transporter permease subunit (Ralstonia sp. UNC404CL21Col)
MSASIWTPLLLSLKVAGWATVLNLVLGVGAAYALARTRSRLRDVIDSVLTLPLVLPPTVL
GYYLLVLLGRRGPIGGWLDSLGIQLVFTWQGAVIASTVVAFPLVMKSARAAFEGVDHQLE
NAARVLGLPETAVFFRVTLPLAARGIAAGVLLAFARALGEFGATLMIAGNLPGRTQTLSV
AIYEAVQAGDDATANTLVLITSLTCIVVLVVASRLLQGRAPNLQEQLV