Protein Info for ABZR87_RS19215 in Ralstonia sp. UNC404CL21Col

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 916 PF00989: PAS" amino acids 45 to 147 (103 residues), 27.9 bits, see alignment E=8.3e-10 amino acids 345 to 449 (105 residues), 27.4 bits, see alignment E=1.2e-09 PF13426: PAS_9" amino acids 51 to 146 (96 residues), 26.6 bits, see alignment E=2.3e-09 PF13185: GAF_2" amino acids 188 to 332 (145 residues), 55.3 bits, see alignment E=3.5e-18 TIGR00229: PAS domain S-box protein" amino acids 341 to 474 (134 residues), 41.1 bits, see alignment E=1.7e-14 PF08448: PAS_4" amino acids 353 to 466 (114 residues), 25.2 bits, see alignment E=6.3e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 474 to 637 (164 residues), 137 bits, see alignment E=5.1e-44 PF00990: GGDEF" amino acids 478 to 635 (158 residues), 161.5 bits, see alignment E=6.1e-51 PF00563: EAL" amino acids 655 to 890 (236 residues), 242.4 bits, see alignment E=1.7e-75

Best Hits

KEGG orthology group: None (inferred from 97% identity to rpf:Rpic12D_4327)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (916 amino acids)

>ABZR87_RS19215 EAL domain-containing protein (Ralstonia sp. UNC404CL21Col)
MTQFLPAQAGASPADVAPSPEAAQRPVAVMAGAMADVRNTDFDALSRLSSDAVLLTVDGR
VVRANPAAARLLGAQDPTQLAGLQLAGLIHPDDVAQTVPRLAGMVSSGVSSQPVEHRLVR
ADYTHVLVASEAAACEHEGQPAVMLVLREAVSRHALERHAVQARAEALHARRLLASENAV
LAQLASNATLSTVLRHLCLYVEQVYPNAMSAVLLLDAASQTLRVAAAPTLPAAYAATLEN
NPVGPDAGACGCAVYLGDTVLIDNIATDPRWQHERTAALSAGFASAWALPIRSSRGDKLG
VLALFYRQPCMPVEEEQHFLDDVTHLAGVAIQKDNVERGLAESEERYRLAISNLHEGVVI
MSPDGVVQAANASAERILRVRPGQLVGRNRLDPIQRVVDEDGKEVGLTMMPSAHVLRTGE
PIFGRVYGLLLKTGELMWVRQNIIPIRRHAEPTPSSVMLSFADITDIKRAEQRLRHLAAH
DALTGLTNRSFFISHLESAIEGARDESRELALFFLDLDRFKSVNDTAGHACGDTLLQSAA
ARLTDCIGPGDVIARLGGDEFVILIDQRVEGKRIALLAERLLQAMREPFDTVNGRYYLGV
SIGVALYPHDGISGSDLLRSADAAMYRAKQNGRNRAQFYTAELNARLQRRYMLENALRDA
RENNELQLVYQPKYDLASHRIVGAEALLRWNSAKLGAISPVEFIPVAEETGLIVPIGAWV
LRRACEQAVIWYEALGYDFRMAVNLSARQFQAGDVVPMIEQTLADTGLPPTALEVEITES
LLMGGADEVRPMFDALTAQGIRISIDDFGTGYSSLSYLQRFPISNVKIDRSFITGIPGDP
DSVALTEAIVAMARALGMTVTAEGVEDADQVEFLAKAGCQEIQGYYIGKPVTAEGFDRLL
RAHLSVVDAGVRAALG