Protein Info for ABZR87_RS19170 in Ralstonia sp. UNC404CL21Col

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details PF00892: EamA" amino acids 10 to 142 (133 residues), 69.9 bits, see alignment E=1.3e-23 amino acids 155 to 291 (137 residues), 73 bits, see alignment E=1.4e-24

Best Hits

KEGG orthology group: None (inferred from 94% identity to rpf:Rpic12D_4318)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>ABZR87_RS19170 DMT family transporter (Ralstonia sp. UNC404CL21Col)
MPKLSGRLEGCLYLALAMVLVGSTVAASKIIAAGLPPFTATALRFAMALPMFLVIMRMTR
SRWPVLARRDWVLLFLQAAAGSVGYTTPLISGLRHTSAADAGVIIGTLPVMSALIAIVLL
GERPGRAVLGAIGLATAGVLTIALQPRGDAAHPLLGNLLVMGAVVCEGLFILLNKRLRTP
VPPLALSALMSAFGLLTALAPALWEAPWQLHASAQTTHALMAVAYYAIVPTVGGFVLWYA
GAARVSGAEASLFTALAPVAAVVFAAALLGETVSTRQIGGIACVLAGVLSLGLARAPRPA
TSTTS