Protein Info for ABZR87_RS19135 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 33 to 55 (23 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 119 to 136 (18 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details amino acids 325 to 345 (21 residues), see Phobius details amino acids 383 to 408 (26 residues), see Phobius details PF05977: MFS_3" amino acids 20 to 407 (388 residues), 125.9 bits, see alignment E=1.7e-40 PF07690: MFS_1" amino acids 33 to 368 (336 residues), 109.2 bits, see alignment E=2.2e-35

Best Hits

KEGG orthology group: None (inferred from 98% identity to rpi:Rpic_4201)

Predicted SEED Role

"MFS general substrate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>ABZR87_RS19135 MFS transporter (Ralstonia sp. UNC404CL21Col)
MSGDAGLSPASSSASAQTLSHAPFSYPAFRLFWFARLSTTFAYQMFGVAVGWQIYDLTRS
AYVLGLVGLAQFLPSVVLVLASGHIADRYDRRYVVRACQAIEALVALALAVMAANGHAGV
QPIFLCVVVIGAMRAFETPTLQALLPTLVPPQALPRAVALSSSAGQTGVILGPALGGFLY
VAGAPVVYATAAGLFMLAHVLLALVRMERAVPVSTPVSLASLFAGIAFIKGRPVVLGAIS
LDLFAVLLGGATALLPIYARDILGTGAWGLGLLRSAPAVGALGMALFLAHRPLDRHVGRV
MFAAVAVFGLATLVFGVSRWLPLSMFALVLLGASDMISVVIRTSLVQLDTPDAMRGRVSA
VNSVFVGASNQLGEFESGMLAGLLGPVASVVIGGLGTLLVVAAWMRLFPALTQRDRMRDP
HPEPAGHPSSGG