Protein Info for ABZR87_RS19095 in Ralstonia sp. UNC404CL21Col

Annotation: gluconate:H+ symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 32 to 53 (22 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 105 to 132 (28 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details amino acids 335 to 384 (50 residues), see Phobius details amino acids 390 to 413 (24 residues), see Phobius details amino acids 425 to 449 (25 residues), see Phobius details TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 10 to 450 (441 residues), 499.9 bits, see alignment E=3.6e-154 PF02447: GntP_permease" amino acids 10 to 447 (438 residues), 537.5 bits, see alignment E=2.5e-165 PF03600: CitMHS" amino acids 22 to 396 (375 residues), 67.1 bits, see alignment E=1.6e-22

Best Hits

Swiss-Prot: 51% identical to GNTP_ZYMMO: Gluconate permease (gntP) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K03299, gluconate:H+ symporter, GntP family (inferred from 100% identity to rpf:Rpic12D_4303)

MetaCyc: 35% identical to fructuronate transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-81; TRANS-RXN0-209

Predicted SEED Role

"Gluconate permease" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>ABZR87_RS19095 gluconate:H+ symporter (Ralstonia sp. UNC404CL21Col)
MVPMQGNSLLLTAALAVVALIYLIAVQKLNPFVTLIVVSLVLGVVVGMPMGNIVKAFETG
VGNTLGHIALVVGLGTMLGKMMAESGGAERIAKTLISAFGEKNAHWAMMVVAFIIGLPVF
FEVGFVLLIPIAFNVAKRTGTPILLVGLPMVAGLSVVHGLIPPHPAALLAVTAYQADIGK
TIMYALIVGLPTAILAGPLWAMLVSRYVKPDENNPLAAQFVEADQKRELPGFGVTLFTIL
LPVVLMLIGSWADLIVPPKTLANDILKLAGNSVMALLIAAIVSFYTFGKARGFNRDTILK
FTNECLAPIATITLVVGAGGGFGQILRDSGVSKAIVAVATDAHLSPLLLGWVVAVLIRIA
TGSATVAMTTACGIVAPIAAASGAAVKPELMVLATGAGSLILSHVNDGGFWLVKEYFNLT
VPQTFKTWTVLETIISIVALLLTLALATVV