Protein Info for ABZR87_RS19070 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 53 to 77 (25 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 115 to 141 (27 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details amino acids 333 to 357 (25 residues), see Phobius details amino acids 369 to 388 (20 residues), see Phobius details amino acids 400 to 421 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 18 to 225 (208 residues), 87 bits, see alignment E=1.3e-28 PF07690: MFS_1" amino acids 21 to 363 (343 residues), 87.6 bits, see alignment E=8.2e-29 amino acids 247 to 431 (185 residues), 41.2 bits, see alignment E=1e-14

Best Hits

KEGG orthology group: None (inferred from 79% identity to bte:BTH_II0241)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>ABZR87_RS19070 MFS transporter (Ralstonia sp. UNC404CL21Col)
MSTLQPSTATHQPVRAATAAFIGTAVEFYDYYTYATAAALVLGEVFFPSSNHFLSTMASF
ATFFVGFIARPLSGAVFGHLGDRIGRKKMLLVTMFLMGIATTGIGLLPGYATIGIWAPIL
LVLLRVLQGIAVGGEWGGAVLMASEHAPKAKRVFFASFPQMGSPVGLILSLLSFRLVSSL
DHESFITWGWRLPFLASFVLLLVGVAIRMGVKESPEFERMKQNNEVLKNPVGEVLRTAWR
PIVLAAMATTIGSAGFFFTNTFMISYVTTYLGMSKALILDCLFVVTILQLLSQPVSALLA
QRYGDTRFLTWAAFISMLTPYPMFLLVSTQNPVAMVAGITLAVVTLSAVYAVIAGFMTPA
FPTRVRYSGISIAYQVCTMIAGGTTPLIGTMLAERYKGEWLPLALFFTVLSAISLIGIIG
LGRYRDGKQPEESTALATN