Protein Info for ABZR87_RS19040 in Ralstonia sp. UNC404CL21Col

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details PF00672: HAMP" amino acids 164 to 215 (52 residues), 39 bits, see alignment 1.3e-13 PF00512: HisKA" amino acids 221 to 275 (55 residues), 41.8 bits, see alignment 1.4e-14 PF02518: HATPase_c" amino acids 317 to 426 (110 residues), 69.3 bits, see alignment E=5.6e-23

Best Hits

KEGG orthology group: K07638, two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC: 2.7.13.3] (inferred from 95% identity to rpi:Rpic_4186)

Predicted SEED Role

"Osmolarity sensory histidine kinase EnvZ"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>ABZR87_RS19040 ATP-binding protein (Ralstonia sp. UNC404CL21Col)
MKFNKIRPRFDTLFGRLAVLIVVVLVLSHFSWLGVLRAERRERQFQASVDQMAFQLQAFQ
AAMDGHLKVKLPDLVTETAEPPAGDASSASDKSAELVRQLARRLPSDTQLRLEAGPTPRV
FVRFPQRNKWIAMPLVWVHAPPTISAVVPGVMVVLAIAIAFSLFAAWQIQRPVRELADAA
GALARRRYVPPLKERGPYELRQLTEQFNHMAADLSATDEERNTMLAGIAHDLKTPLSRLR
LRAEMLADQKAGAGIERDVESMSAIVEQFLAYAQSGDSEAREVSVDRHLRGLVQPFAEQG
KHVALDLHAGDRFRLKPTHLERIVVNLLDNAFAYGAEPVNVRTAVDDAGYTLTVEDHGAG
IPAADFDRVMRPFVRLDPARGGNAHCGLGLAIVDRLVRHLGGDLAVGPTAADASAPGFRI
TMRFPVSTAAT