Protein Info for ABZR87_RS19005 in Ralstonia sp. UNC404CL21Col

Annotation: sensor domain-containing diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 TIGR00229: PAS domain S-box protein" amino acids 5 to 123 (119 residues), 77.8 bits, see alignment E=8.1e-26 amino acids 128 to 251 (124 residues), 34 bits, see alignment E=2.8e-12 PF13188: PAS_8" amino acids 7 to 60 (54 residues), 25.7 bits, see alignment 2.8e-09 PF00989: PAS" amino acids 8 to 116 (109 residues), 51.9 bits, see alignment E=2.6e-17 PF08448: PAS_4" amino acids 13 to 120 (108 residues), 39.1 bits, see alignment E=2.8e-13 PF13426: PAS_9" amino acids 18 to 118 (101 residues), 34.9 bits, see alignment E=5.6e-12 amino acids 154 to 248 (95 residues), 15.3 bits, see alignment E=6.9e-06 PF14598: PAS_11" amino acids 24 to 107 (84 residues), 26.2 bits, see alignment E=2.2e-09 PF08447: PAS_3" amino acids 29 to 107 (79 residues), 47.1 bits, see alignment E=8.1e-16 amino acids 154 to 242 (89 residues), 71.4 bits, see alignment E=2.1e-23 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 258 to 417 (160 residues), 146.5 bits, see alignment E=6.3e-47 PF00990: GGDEF" amino acids 260 to 416 (157 residues), 166 bits, see alignment E=2.2e-52

Best Hits

KEGG orthology group: None (inferred from 96% identity to rpi:Rpic_4179)

Predicted SEED Role

"FIG00977462: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>ABZR87_RS19005 sensor domain-containing diguanylate cyclase (Ralstonia sp. UNC404CL21Col)
MLEDHHLYKAAIEHSPIGIGLCAPEGRFLDVNRALCALTGHEAQALRTRDLFDLCHPDHT
ERTRHGVESLLAGQRDALSMETRLVRQDGTTVWVQTDVAVARDAGSQHLVVQMQDVTARR
LALESLRASEQRLAYVLDGAGLGTFDWSTRARHVSFNRRTADMLGYEPTDLPNDPDAWYA
MVHPQDAALSARRIYRHMRGDADSFEIEQRMRARHGQWIWVAARGRVTERDARGVATRVS
GTLLDVTQRRAALDQAHHLALHDPLTDLPNARLLRDRLFVAIQAARRARGQVAVVFIDLD
RFKPVNDEYGHAVGDLVLKATAMRLRSGLRASDTVARLGGDEFVAVLTHCATREDVTQTV
ERLIEQLQTPFRVEGHVLSMGVSAGVALYPTDGHDAQSLIRNADAAMYEVKRAGGNGLGF
HASLNYERLMGMRSRNRDLDLDGEADAR