Protein Info for ABZR87_RS18865 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details amino acids 366 to 389 (24 residues), see Phobius details amino acids 398 to 418 (21 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 357 (333 residues), 97.7 bits, see alignment E=3.4e-32

Best Hits

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 99% identity to rpi:Rpic_4163)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>ABZR87_RS18865 MFS transporter (Ralstonia sp. UNC404CL21Col)
MTGKATRIDLFSLRTPQMRAFHLTWLAFFVCFYAWFACAPLMPVLKGEFHLTPGQIANIN
IAAVAVTILVRLIVGPLCDRFGPRKTYTGLLLLGAIPVLGVALAQSYETFLFFRLAIGAI
GASFVITQYHTSVMFAPNVVGTANAAAAGWGNAGGGVAQGTMPLLLTAIVMMGVTQSMGW
RIAMVVPGVAMLIVAALYWRYTQDCPEGNFSALRAAGKTIDGGKKGGWGSFVTAAGNYRV
WLLFITYGACFGVEIFIHNIAATYYVDHFGLSLSAAGMAAASFGLLALFARALGGIVSDR
VAAKRGLDARTQLLCLLMLGEGLGLFGFAHAGSVPVAILAMLGFGLFTHMACGATYALVP
FIDRRALGGVAGIIGAGGNAGAVAAGFLLKGMADTQATLSILGVLVALSAICAIAVRFSA
EHKAREQALYDNTLAAAGNA