Protein Info for ABZR87_RS18835 in Ralstonia sp. UNC404CL21Col

Annotation: cytochrome d ubiquinol oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 154 to 178 (25 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 226 to 249 (24 residues), see Phobius details amino acids 265 to 288 (24 residues), see Phobius details amino acids 308 to 328 (21 residues), see Phobius details PF02322: Cyt_bd_oxida_II" amino acids 14 to 333 (320 residues), 284.6 bits, see alignment E=5.3e-89

Best Hits

KEGG orthology group: K00426, cytochrome bd-I oxidase subunit II [EC: 1.10.3.-] (inferred from 99% identity to rpi:Rpic_4158)

Predicted SEED Role

"Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>ABZR87_RS18835 cytochrome d ubiquinol oxidase subunit II (Ralstonia sp. UNC404CL21Col)
MNAIPDLTQPAGWLPVVFMALMGIAVLAYVVLDGYDLGVGILLRRADDAEKDTMIASIGP
FWDANETWLVLGVGLLLVAFPAAHGEILGALYLPVALMLFGLILRGVAFDFRVKARAHHK
PWWNRAFYAGSVIATAAQGLMLGLYITGFQYDAANVIFAICTAGGLIAGYLLLGATWLIM
KTEGALQLRAVQWARGSLWFTALGVAAVSLATPWVSTRVFDKWFALPNIILLAPVPLVTI
VLFLLIDWVLRRLPQQIAKGDEHLIWAPFVGTGAIFLLAFNGLAYSLFPYLVVDRLDIWQ
AASAPESLEFMLVGVAIVLPTIVGYTIYSYKVFHGKATELRYY