Protein Info for ABZR87_RS18650 in Ralstonia sp. UNC404CL21Col

Annotation: YnfA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 34 to 53 (20 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details PF02694: UPF0060" amino acids 4 to 106 (103 residues), 125 bits, see alignment E=7.5e-41

Best Hits

Swiss-Prot: 94% identical to Y4131_RALPJ: UPF0060 membrane protein Rpic_4131 (Rpic_4131) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K09771, hypothetical protein (inferred from 94% identity to rpi:Rpic_4131)

Predicted SEED Role

"Protein of unknown function UPF0060"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (110 amino acids)

>ABZR87_RS18650 YnfA family protein (Ralstonia sp. UNC404CL21Col)
MELLRIAVLFAVTAVAEIVGCYLPWLVLRQGKPIWLLLPAAASLALFAWLLTLHPTAAGR
TYAAYGGVYIAVALVWLRLVDGVTLTRWDIGGAAIALAGMAVIALQPQAN