Protein Info for ABZR87_RS18635 in Ralstonia sp. UNC404CL21Col

Annotation: multidrug transporter subunit MdtD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 114 to 123 (10 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 202 to 220 (19 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 299 to 320 (22 residues), see Phobius details amino acids 335 to 353 (19 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details amino acids 399 to 422 (24 residues), see Phobius details amino acids 437 to 457 (21 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 20 to 421 (402 residues), 258.3 bits, see alignment E=6.8e-81 PF07690: MFS_1" amino acids 21 to 411 (391 residues), 156.2 bits, see alignment E=1.1e-49 amino acids 274 to 454 (181 residues), 35.7 bits, see alignment E=5e-13 PF05977: MFS_3" amino acids 36 to 186 (151 residues), 32 bits, see alignment E=5e-12

Best Hits

Swiss-Prot: 53% identical to MDTD_PECAS: Putative multidrug resistance protein MdtD (mdtD) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: None (inferred from 99% identity to rpi:Rpic_4128)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (476 amino acids)

>ABZR87_RS18635 multidrug transporter subunit MdtD (Ralstonia sp. UNC404CL21Col)
MPTTPSASVDPSLKPLLWLVAMGLFMQTLDSTIVNTALPAMARSLSESPLKMQSVIIAYT
LTTAMLMPASGWMADRFGTRKMFFAAIFLFTIGSLLCAESRSLTMLIASRVVQGVGGALL
MPVGRLTVLRVVPREQFLPAMSFVTIPGLIGPLIGPTLGGWLVEAVSWHWIFLINIPVGV
IGALVTLKVMPDVHAEDDSRFDWSGYLMLAFGMAAVSFSLDGLSELGFQHATVLVLLIFG
LAALTAYWLHAGRVAGPLFPRTLFGIPSFSIGVLGNLFARIGSGGMPFLIPLLLQVSLGY
TPLQAGLMMVPVAAAGMAAKPLGTWAIKRYGYRRMLSVNTVMVGLMMASFAVMTPNVPVW
LRIVQLAIFGTFNSMQFTAMNTLTLKDLTGPLASAGNSMLSMVMMLSMSLGVAAAGALLT
GFTDFTAGPEGRDTLAAFHKTFVCVGVMTCAAAWIFAQLSRFESTHVVKRPEMEVH