Protein Info for ABZR87_RS18620 in Ralstonia sp. UNC404CL21Col

Annotation: adenosylmethionine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03330: S-adenosylmethionine decarboxylase proenzyme
  • amino acids 16 to 135 (120 residues), 112.2 bits, E=8.3e-37
• PF02675: AdoMet_dc
  • amino acids 20 to 135 (116 residues), 118.8 bits, E=6.7e-39

Best Hits

KEGG orthology group: K01611, S-adenosylmethionine decarboxylase [EC: 4.1.1.50] (inferred from 92% identity to rpf:Rpic12D_4237)

Predicted SEED Role

"S-adenosylmethionine decarboxylase proenzyme (EC 4.1.1.50), prokaryotic class 1B" in subsystem Polyamine Metabolism (EC 4.1.1.50)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• superpathway of polyamine biosynthesis I (7/8 steps found)
• spermidine biosynthesis I (2/2 steps found)
• aminopropylcadaverine biosynthesis (2/3 steps found)
• spermine biosynthesis (1/2 steps found)
• superpathway of polyamine biosynthesis II (5/8 steps found)
• spermidine biosynthesis III (2/4 steps found)
• L-methionine salvage cycle I (bacteria and plants) (4/12 steps found)
• L-methionine salvage cycle III (3/11 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Methionine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.50

Protein Sequence (141 amino acids)

>ABZR87_RS18620 adenosylmethionine decarboxylase (Ralstonia sp. UNC404CL21Col)
MTRTDAALSAEEASAAVGEHLLLDLYGVAPALLRDAAALETALRDAADALGATILHAHLH
RFDSVRTGLPVGEQGGVTGVLLLAESHLSIHTWPEHGFAAIDAFMCGTGTTHAARAVFER
ALTPQRVDVRVARRGTAPPSN