Protein Info for ABZR87_RS18600 in Ralstonia sp. UNC404CL21Col

Annotation: DUF350 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details PF03994: DUF350" amino acids 16 to 67 (52 residues), 49.4 bits, see alignment E=2e-17 amino acids 79 to 131 (53 residues), 46.8 bits, see alignment E=1.2e-16

Best Hits

KEGG orthology group: K08989, putative membrane protein (inferred from 98% identity to rpi:Rpic_4121)

Predicted SEED Role

"surface protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (132 amino acids)

>ABZR87_RS18600 DUF350 domain-containing protein (Ralstonia sp. UNC404CL21Col)
MPDMTASVIAYASHLLAGAVVFSGFFFVYLRLTPYDEFKLIREGNIAAALSLAGALLGFV
LTIASSITHADGLVPFLFWAVMASVVQLVVFLVLTRLMPDYRLQIEHNNIAAGMLFGVSA
LAVGVINAACLS