Protein Info for ABZR87_RS18595 in Ralstonia sp. UNC404CL21Col

Annotation: polyamine aminopropyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 transmembrane" amino acids 21 to 47 (27 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 215 to 233 (19 residues), see Phobius details PF01564: Spermine_synth" amino acids 286 to 461 (176 residues), 112.8 bits, see alignment E=7.4e-37

Best Hits

Swiss-Prot: 94% identical to SPEE1_RALSO: Polyamine aminopropyltransferase 1 (speE1) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00797, spermidine synthase [EC: 2.5.1.16] (inferred from 98% identity to rpi:Rpic_4120)

Predicted SEED Role

"Spermidine synthase (EC 2.5.1.16)" in subsystem Polyamine Metabolism (EC 2.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.16

Use Curated BLAST to search for 2.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (525 amino acids)

>ABZR87_RS18595 polyamine aminopropyltransferase (Ralstonia sp. UNC404CL21Col)
MSTPQPDATYEPTQPAGRGNALLVLAVFVVASCGLAYELIAGALASYLLGDSILQFSSII
GAYLFAMGIGSWLSRYVADEALLARFVDLELLVGLFGGVSAAALFALFALESAPFRLVLY
ALVTVIGVLVGMEIPLVMRMLHRRQAKFSDLVSRVLTFDYLGALAVSLLFPLVLAPRLGL
VRTGFLFGLFNTAIAVWTLWHFRTELALTARMRTAMAWRAGAVAAALLAGFGASDKLTHW
SERALFGDEIIHAISSPYQRLVVTRWKDDLRLYINGNLQFSSRDEYRYHEALALPALESV
RGARRVLVLGGGDGLALRQILKYPQIEHVTLVDLDPRMTNLFSHAEALVALNQHAFSDPR
VTVVNADAAQWMQTATDMFDVAIVDFPDPSNFSIGKLYSVPFYRLLSRHVADTGLVVIQA
TSPYFAPRSYWCVDATLKEAGYRTWPYHALVPSFGEWGFILAAPGRADFKPPMSYRVPTR
FLDADTTHQMFSFAPDMPRPQVEPNRLNNQSLVRYFEEDWHGVLR