Protein Info for ABZR87_RS18550 in Ralstonia sp. UNC404CL21Col

Annotation: alkane 1-monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details amino acids 251 to 269 (19 residues), see Phobius details amino acids 334 to 353 (20 residues), see Phobius details PF00487: FA_desaturase" amino acids 114 to 341 (228 residues), 107.9 bits, see alignment E=3.8e-35

Best Hits

Swiss-Prot: 46% identical to ALKB_PSEPU: Alkane 1-monooxygenase (alkB) from Pseudomonas putida

KEGG orthology group: K00496, alkane 1-monooxygenase [EC: 1.14.15.3] (inferred from 98% identity to rpi:Rpic_4109)

MetaCyc: 53% identical to alkane hydroxylase (Mycobacterium tuberculosis H37Rv)
Alkane 1-monooxygenase. [EC: 1.14.15.3]

Predicted SEED Role

"Alkane-1 monooxygenase (EC 1.14.15.3)" (EC 1.14.15.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.15.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>ABZR87_RS18550 alkane 1-monooxygenase (Ralstonia sp. UNC404CL21Col)
MATPGMVASVEWTDGKRYLWMLGALTITLPIVAAVSALATGWHPLWWAGPFIVFTIIPLL
DFLIGDDRDNPPEDVVPTLEKQRYYRRIVYLATTVLYVSFAVAMWVLRTYDLVWYDYIAF
AFSVGVVTGISINTAHELGHKTDGFERWLAKITLAPVAYGHFFVEHNRGHHVRVATPADP
ASARYGESFWEFLPRTVVGSVKSAWALEKRRLEQHGHSVWSWRNDVLNAWAMTVVLWGVC
IAFVGPKAVPFLIIQAIYGASLLEVVNYLEHYGLCRQQLPSGRYERCTPQHSWNSNHVVT
NLFLYQLQRHADHHANPTRSFQALRHFEHSPQLPAGYAAMILIAYVPPLWFRVMNPRVVA
HYNGNMSLANIKPSIRDKVLAQYPARA