Protein Info for ABZR87_RS18495 in Ralstonia sp. UNC404CL21Col

Annotation: multidrug transporter subunit MdtD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 228 to 246 (19 residues), see Phobius details amino acids 267 to 291 (25 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 329 to 351 (23 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details amino acids 397 to 421 (25 residues), see Phobius details amino acids 430 to 450 (21 residues), see Phobius details PF05977: MFS_3" amino acids 8 to 195 (188 residues), 31.3 bits, see alignment E=1.2e-11 PF00083: Sugar_tr" amino acids 19 to 118 (100 residues), 30.8 bits, see alignment E=2.3e-11 TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 21 to 412 (392 residues), 243.3 bits, see alignment E=2.4e-76 PF07690: MFS_1" amino acids 22 to 409 (388 residues), 166.9 bits, see alignment E=9.1e-53 amino acids 323 to 464 (142 residues), 34 bits, see alignment E=2.4e-12

Best Hits

KEGG orthology group: None (inferred from 80% identity to rme:Rmet_4177)

Predicted SEED Role

"putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (472 amino acids)

>ABZR87_RS18495 multidrug transporter subunit MdtD (Ralstonia sp. UNC404CL21Col)
MQTVPTPAAPQSASQNAMLWIVFAGFFMQALDTTIVNTALPSMARSLGEKPLDLKSVVVA
YTLTMAMLTPASGWLADKFGTRRVYFTAILIFVLGSVFCATAHTLPQLVIARVLQGIGGS
MLLPIGRLAVLRNIPGEQYIAALAFVSVAGQVGPLLGPALGGWLVQDVSWHWIFLINVPV
GFVGLFAVRRYLPHDAVRAVAPFDWLGCGLLSLCMVAFSLALENGAQSPWSAVLIAVSVV
SALLYIPHAKRRAAPLFQLALFREPNFSVGLVGNLFCRIGSGAVPFLLPLLFQLQLGYSP
LHSGLLLLPIAIAGMLAKRWVVPLVNRFGYDVFLQVNTWVVGISIASFAAMSPGWPLALS
IVQLSVFGWANSMQFAAMNSITLKGLSHQDAGSGNSLFSMVQMLAIGLGVSIGGGLVSLF
SVKLGVAAPAYRLAFFTMGVVTAFSALIFRKLDAKSKPARAKNVEAEAVQAR