Protein Info for ABZR87_RS18435 in Ralstonia sp. UNC404CL21Col

Annotation: 2-dehydropantoate 2-reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01210: NAD_Gly3P_dh_N" amino acids 2 to 136 (135 residues), 31.5 bits, see alignment E=3.3e-11 PF03807: F420_oxidored" amino acids 2 to 103 (102 residues), 25.2 bits, see alignment E=4.3e-09 TIGR00745: 2-dehydropantoate 2-reductase" amino acids 2 to 304 (303 residues), 244.9 bits, see alignment E=5.8e-77 PF02558: ApbA" amino acids 3 to 152 (150 residues), 132.5 bits, see alignment E=2e-42 PF08546: ApbA_C" amino acids 178 to 303 (126 residues), 112.9 bits, see alignment E=2.6e-36

Best Hits

KEGG orthology group: K00077, 2-dehydropantoate 2-reductase [EC: 1.1.1.169] (inferred from 87% identity to bcm:Bcenmc03_6401)

Predicted SEED Role

"2-dehydropantoate 2-reductase (EC 1.1.1.169)" in subsystem Coenzyme A Biosynthesis (EC 1.1.1.169)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.169

Use Curated BLAST to search for 1.1.1.169

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>ABZR87_RS18435 2-dehydropantoate 2-reductase (Ralstonia sp. UNC404CL21Col)
MKIAILGAGALGCAIGAALTEGGHEAWLISRSPAHVNAMRGEGLRVDDAQGTRRIPVLAA
TQAAEVGVAELVIVLVKSFQTDAAMRGAAALVGPDTLVLSLQNGLGHEAILADIVGRERV
LAGKTYVGGVLRGPGHIQSGVVGKATYIGELDGRLTPRVQAIAEAFNAAGLATTVSDNIV
GTMWDKLLVNVATGALTGITRLTYGQLYEDALLKATSLAAVAEAIAAAQAAGVKLSMTDP
EQAWALAAEGLPAAFKTSMLQSLEKGSITEIDFINGSVVRYGQQYGVPTPVNATLVACIK
GIERAMADRQREEAAA