Protein Info for ABZR87_RS18280 in Ralstonia sp. UNC404CL21Col

Annotation: cysteine hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00857: Isochorismatase
  • amino acids 10 to 182 (173 residues), 103.8 bits, E=6.1e-34

Best Hits

KEGG orthology group: K05993, isochorismatase [EC: 3.3.2.1] (inferred from 99% identity to rpi:Rpic_4084)

Predicted SEED Role

"Amidases related to nicotinamidase" in subsystem NAD and NADP cofactor biosynthesis global

MetaCyc Pathways

• superpathway of chorismate metabolism (44/59 steps found)
• 2,3-dihydroxybenzoate biosynthesis (1/3 steps found)
• enterobactin biosynthesis (4/11 steps found)
• vibriobactin biosynthesis (1/9 steps found)
• bacillibactin biosynthesis (3/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Biosynthesis of siderophore group nonribosomal peptides

Isozymes

Compare fitness of predicted isozymes for: 3.3.2.1

Use Curated BLAST to search for 3.3.2.1

Protein Sequence (219 amino acids)

>ABZR87_RS18280 cysteine hydrolase family protein (Ralstonia sp. UNC404CL21Col)
MTTNNTPKRALIVIDVQNEYFTGGLPIEYPDPQQTVANIGVAMDAAREAGIPVIVVQQTS
PASSPLFAIDTDGWQLHPVVASRPHDHYLRKLLPSAYPETDLAQWLEARGIDTLTVVGYM
THNCDASTINHALHNGTAVEFLHDASGAVPYQNQAGFASAEEIHRVFSVVLQSRFAAVMS
TQEWVHSVKTGAVPVRDNIYKSNQRARGLLKDGVAQQAA