Protein Info for ABZR87_RS18230 in Ralstonia sp. UNC404CL21Col

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 247 to 270 (24 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 350 to 362 (13 residues), see Phobius details amino acids 374 to 394 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 62 to 207 (146 residues), 53.3 bits, see alignment E=1.2e-18 amino acids 238 to 389 (152 residues), 88.5 bits, see alignment E=2.2e-29

Best Hits

KEGG orthology group: K10544, D-xylose transport system permease protein (inferred from 97% identity to rpi:Rpic_4076)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>ABZR87_RS18230 sugar ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MTSQTSPQAAGRVADSRNTFKASQRLRQLFARYKILALLIAVAAIWLFFSMLTNGAFTSP
RNLSNLLRQMSITGMLACGMVFVIIAGEIDLSVGSLLGLLGGVAAILDQGLGWPITATVP
VVLLLGVGMGLFNGWWSTYRGVPSFIVGLGGMLAYRGILLGLTHGSTIAPVSDSFVLIGQ
GYLPRRVGDLMAVLIFCLLIFVVIRQRREHRRYELDVAPLWQDVAKLVVAGAVIVAFVAT
LNSYGGIPVPVLLVLALLGIFSWIASQTVFGRRIYSVGSNLEATRLSGINTDRVKLAIFG
LMGLMCAFAGIVNTARLAAGSPSAGTMGELDAIAACFIGGTSMRGGAGTVYGALVGALVM
ASLDNGMSMLDVDAYWQMIVKGGILVLAVWVDVISRSVRR