Protein Info for ABZR87_RS18225 in Ralstonia sp. UNC404CL21Col

Annotation: D-xylose ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 TIGR02633: D-xylose ABC transporter, ATP-binding protein" amino acids 5 to 504 (500 residues), 896 bits, see alignment E=3e-274 PF00005: ABC_tran" amino acids 21 to 173 (153 residues), 100 bits, see alignment E=1.8e-32 amino acids 281 to 435 (155 residues), 72.9 bits, see alignment E=4.4e-24

Best Hits

Swiss-Prot: 83% identical to XYLG_PARXL: Xylose import ATP-binding protein XylG (xylG) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K10545, D-xylose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 97% identity to rpi:Rpic_4075)

Predicted SEED Role

"D-xylose transport ATP-binding protein XylG" in subsystem Xylose utilization

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (527 amino acids)

>ABZR87_RS18225 D-xylose ABC transporter ATP-binding protein (Ralstonia sp. UNC404CL21Col)
MSEPLLQMRGIVKTFDGVKALDGINLVVKPGECVGLCGENGAGKSTLMKVLSGVYPSGTW
DGEILWEGRPLHASGIRDTERAGIVIIHQELMLVPELSVAENIYLGNEITLPGGRMNYAA
MYQGADKLLRDLNIQGINVALPVMHYGGGHQQLIEIAKALNKRAKLLILDEPSSSLTAAE
TRILLDIVRDLKARGIACVYISHKLDEVEAVCDTVTVIRDGRHVATAPMDALTTDRIIAH
MVGREITQLFPREPHPIGEVVFEARNVTCYDVNNPARKRVDGVSFAVRRGEILGVAGLVG
AGRTELMQAVFGAYEGASEADLVLDGKPLKIRAPLDAIRAGIAMVPEDRKRHGIVSLMSV
GHNITLAVLQRFARLGRIDGAAELDTIRKEMRRLAVRAAHPMLPIASLSGGNQQKAVLTR
MLLTEPRVLILDEPTRGVDVGAKYEIYKLIGDLAKRGMAIIVISSELPEVLGISDRVLVI
GEGELRGDFVNDGLTQEHILTAAIQPVRHTPRHTPGHAPTLHQAGHA