Protein Info for ABZR87_RS18215 in Ralstonia sp. UNC404CL21Col

Annotation: DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 PF13377: Peripla_BP_3" amino acids 122 to 282 (161 residues), 105 bits, see alignment E=7.3e-34 PF12833: HTH_18" amino acids 321 to 400 (80 residues), 68.4 bits, see alignment E=8.2e-23 PF00165: HTH_AraC" amino acids 362 to 398 (37 residues), 31 bits, see alignment 3.3e-11

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 97% identity to rpi:Rpic_4073)

Predicted SEED Role

"Xylose activator XylR (AraC family)" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>ABZR87_RS18215 DNA-binding transcriptional regulator (Ralstonia sp. UNC404CL21Col)
MHRQLPDPSQHARIHRIALLFNANKVYDREIIAGIGDYMRSTRVTWDLFLEEDFRCRLPG
IERFDGDGIIADFDDPAVAEALRGCPLPVVAVGSSYEDPAHYPAKEPYVATDNGKLVALA
YRHLIEAGLQHFALYSLPQAPENRWAQQRELAFTRLRRQDNPATPVDQEIYRGLSTSAPT
WHQAISQLIEWLRGLPKPIGIIAVTDARARHLLQACMTAGFAVPEEIAIIGIDNDPLTRT
LSRIPLSSVIQGTVEMGRTAAHLLHQMLGGARLAGRQILVPPVGINVLASSRHQPLASPY
VMRARHFIRQYACQGIKTEQVADYVGISRSSLEEHFRRELHCTVHQEILRHKLDAAKHML
ASRDVATAEVAVRCGFTSPQYMHAVFRRELDCTPREYQERATTESQS