Protein Info for ABZR87_RS18205 in Ralstonia sp. UNC404CL21Col

Annotation: nucleobase:cation symporter-2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 35 to 59 (25 residues), see Phobius details amino acids 66 to 89 (24 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details amino acids 269 to 296 (28 residues), see Phobius details amino acids 347 to 369 (23 residues), see Phobius details amino acids 375 to 396 (22 residues), see Phobius details amino acids 408 to 428 (21 residues), see Phobius details amino acids 438 to 457 (20 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 28 to 455 (428 residues), 386.1 bits, see alignment E=2.2e-119 PF00860: Xan_ur_permease" amino acids 32 to 425 (394 residues), 338 bits, see alignment E=3.2e-105 TIGR03173: xanthine permease" amino acids 35 to 458 (424 residues), 519.6 bits, see alignment E=5e-160

Best Hits

KEGG orthology group: None (inferred from 98% identity to rpf:Rpic12D_4183)

Predicted SEED Role

"Xanthine-uracil permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (475 amino acids)

>ABZR87_RS18205 nucleobase:cation symporter-2 family protein (Ralstonia sp. UNC404CL21Col)
MRQSPGQPSPSSSTITGAIADPVNEFLPLPRLFALGLQHLLVMYAGAIAVPLIVGNALGL
SKSDLSYLVNCDLFAAGIGTLIQSLGFLIFGIRLPVMMGVTFAAVAPMIAIGVEPGMGLP
GIFGASIVSGVFGIAVAPLMGRLLGLFPRVVTGTVIMLIGFSLLSVGINWAAGGQQMIPQ
VVDGVKHMVPNPAFGDPFGLAIAALVLVTILLLTKFGNALLCNIAVLLGIVTGTLVAAAF
GKVSLADASAAPLMTLVTPFYFGMPKFELSAIISMCIVIVITLVESTGMFLALAHVVGKP
ISRNELTNGLRADGLATVVAGVFNTFPHTSFSQNIGLVSITGVRSRYVAAAGGVLLIVLG
LFPKLSYVVASVPQYVLGGAGIVMFGMVAAAGIRMLGMVDFQQQRHNLLIIAVSVGFGMM
PTLAPAFFHHFPDWTRPITHSGIVMGTLVAVVLNAWFNGIRGSHEVMHGAAAAAH