Protein Info for ABZR87_RS18085 in Ralstonia sp. UNC404CL21Col

Annotation: type III secretion system ATPase SctN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 TIGR01026: ATPase, FliI/YscN family" amino acids 39 to 457 (419 residues), 553.6 bits, see alignment E=3e-170 TIGR02546: type III secretion apparatus H+-transporting two-sector ATPase" amino acids 44 to 459 (416 residues), 616.4 bits, see alignment E=2.3e-189 PF02874: ATP-synt_ab_N" amino acids 50 to 114 (65 residues), 26.7 bits, see alignment E=9.6e-10 PF00006: ATP-synt_ab" amino acids 171 to 380 (210 residues), 284.2 bits, see alignment E=9.8e-89 PF18269: T3SS_ATPase_C" amino acids 388 to 454 (67 residues), 80.3 bits, see alignment E=1.2e-26

Best Hits

Swiss-Prot: 57% identical to HRPB6_XANEU: Probable ATP synthase hrpB6 (hrpB6) from Xanthomonas euvesicatoria

KEGG orthology group: K03224, ATP synthase in type III secretion protein SctN [EC: 3.6.3.14] (inferred from 68% identity to bcm:Bcenmc03_5437)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>ABZR87_RS18085 type III secretion system ATPase SctN (Ralstonia sp. UNC404CL21Col)
MTSPDSQSALPDWSRAWGDALGGVFDAQALEAELSQALDRFAPIQTQGRVTRAVGLLLSA
SGLQARLGEICQLRTPGTPDTLAEVVGFSRSGTLLTPLGETSGLSAATAVIPTGRDHSFP
VGPALLGRVLDGFGQPLDRAGPVAAVTRASAYGAPPNPLDRQLVDKPLATGVRAIDALLT
VGVGQRVGILAPAGVGKSTLLGMIARGATADVNVVALIGERGREVREFIEHHLPKQARAR
TVLVVSTSDRPAMERVKSAFVATAIAEYFRDQGQSVLLLMDSLTRFARAQREVGLASGEP
PARRSFPPSTFAMLPRLLERAGPGAKGSITAFYTVLVEGEEESDPIAEEVRSIVDGHIVL
TRKLATEGQYPPIDLLASISRVMPNVADAGHMETASQLRRWLARYQEIELLLQIGEYKAG
SDPDVDRAVAARDALRRFFAQRTDERVRFEDVLTEGRQLVERYGHDTGHPAPRA