Protein Info for ABZR87_RS18070 in Ralstonia sp. UNC404CL21Col

Annotation: EscU/YscU/HrcU family type III secretion system export apparatus switch protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 80 to 104 (25 residues), see Phobius details amino acids 138 to 162 (25 residues), see Phobius details amino acids 181 to 206 (26 residues), see Phobius details PF01312: Bac_export_2" amino acids 3 to 338 (336 residues), 275.4 bits, see alignment E=3.6e-86

Best Hits

KEGG orthology group: K03229, type III secretion protein SctU (inferred from 46% identity to bvi:Bcep1808_5332)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>ABZR87_RS18070 EscU/YscU/HrcU family type III secretion system export apparatus switch protein (Ralstonia sp. UNC404CL21Col)
MSDKPHQPTRKRLEDRRKRGEVVRSQEVVSALVFTCMVGALSLTPALWMDSIRAGLATLG
RVLAAPEPAKLIGPLVADLAIHAAGLAVGIIALSGFIAALTAFAQVGALMSPAKITPDLS
RLNPANGLTRMFSMRNLAGLGLMVLKVLCLLGILFVVGAGAIDALLSAGRQSPAQILQVG
AHVVLVLLSCVAIMLLVLAAADYMVVRAQYLKEARMTTEEIRREYRENEGDPHLRARRRQ
LAREAQWSALPDRIRLAVVVVYSPQYAVALWYGGQGTLPVVVARGEGEMAERIRKLAEAQ
LIQTHGNPGLASKLYEQVQLDAAIDRTLFREVAETLRWATGASQTSA