Protein Info for ABZR87_RS17865 in Ralstonia sp. UNC404CL21Col

Annotation: cation:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 148 to 172 (25 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 230 to 260 (31 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details amino acids 307 to 330 (24 residues), see Phobius details amino acids 337 to 361 (25 residues), see Phobius details amino acids 371 to 390 (20 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 12 to 387 (376 residues), 261.5 bits, see alignment E=6.1e-82

Best Hits

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 99% identity to rpf:Rpic12D_4142)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system protein KefB" in subsystem Glutathione-regulated potassium-efflux system and associated functions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>ABZR87_RS17865 cation:proton antiporter (Ralstonia sp. UNC404CL21Col)
MHVDTPLISTIIGGIVLAFIFGTIAQRLRLPPLVGYLMAGVVAGPFTPGFVADQSLAPQL
AELGVILLMFGVGLHFSMKELLAVKAIAIPGAIGQIALATLMGMGLAWLLGWDWGPGLVF
GLALSVASTVVLLKALEDRGIDNSHEGHIAVGWLIVEDLVMVVTLVLLPALAGALGGAGS
TAVSTWDIVKVLAVTLSKVVAFAALMLVVGRRVIPWMLERIVMTGSRELFRLGVLATALG
VAYGATVLFGVSFALGAFFAGMVLAESEFSQRAAEESLPLRDAFAVLFFVSVGMLFDPRV
LIEDPWAVLGTVLIVVVGKSLAAFAVVRAFGHGNRTALTISASLAQIGEFSFILIGLGIS
LEILPDRARGLLLSAAILSILLNPLMFALINRLKREVAPEPATAD