Protein Info for ABZR87_RS17840 in Ralstonia sp. UNC404CL21Col

Annotation: 3-oxoacyl-[acyl-carrier-protein] synthase III C-terminal domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08545: ACP_syn_III
  • amino acids 112 to 191 (80 residues), 81.2 bits, E=4.1e-27
• PF08541: ACP_syn_III_C
  • amino acids 246 to 331 (86 residues), 87.7 bits, E=4.9e-29

Best Hits

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 60% identity to ctu:CTU_24930)

Predicted SEED Role

"3-oxoacyl-(acyl carrier protein) synthase (EC 2.3.1.41)" (EC 2.3.1.41)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (50/53 steps found)
• palmitate biosynthesis III (28/29 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• tetradecanoate biosynthesis (mitochondria) (23/25 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (19/20 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (12/12 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (9/9 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• biotin biosynthesis I (13/15 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• superpathway of fatty acid biosynthesis initiation (4/5 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• fatty acid biosynthesis initiation (mitochondria) (2/4 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (25/205 steps found)
• superpathway of mycolate biosynthesis (26/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180, 2.3.1.41

Use Curated BLAST to search for 2.3.1.180 or 2.3.1.41

Protein Sequence (332 amino acids)

>ABZR87_RS17840 3-oxoacyl-[acyl-carrier-protein] synthase III C-terminal domain-containing protein (Ralstonia sp. UNC404CL21Col)
MPASMLPIHLLSTGKALPEQQVTSAELDARLGHRAGYVRKKSGIDVRHHATLAEHQSELA
GAAVRDALRRADVPAASIDLLISASGVQEQALPNTAAHILEPAGLPAGTPAFDVNASCLS
FVTALHVAGSLLTTGAYRRIAVVASDLASRGIDWDDAETALIFGDGAAAVIVEAAPSQSG
AGIHAYRMETYPAGKTYCEIRAGGTRRNPRTGAQPTDYLFHMDGKRVFKLASQLMDGFLD
RLFAGSQYTLRDMHVVVPHQASHLGMQHLRKRLGVPEASVVDIYAQHGNQVAASIPTALH
EAVTTRRMEPGKPVLLVGTAAGLTLGGMVLTL