Protein Info for ABZR87_RS17835 in Ralstonia sp. UNC404CL21Col

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF04321: RmlD_sub_bind" amino acids 1 to 188 (188 residues), 50.8 bits, see alignment E=5.3e-17 PF16363: GDP_Man_Dehyd" amino acids 4 to 324 (321 residues), 41.7 bits, see alignment E=4.3e-14 PF01073: 3Beta_HSD" amino acids 4 to 256 (253 residues), 82.3 bits, see alignment E=1.3e-26 PF05368: NmrA" amino acids 4 to 116 (113 residues), 39.3 bits, see alignment E=2e-13 PF01370: Epimerase" amino acids 4 to 232 (229 residues), 109.8 bits, see alignment E=6.1e-35 PF13460: NAD_binding_10" amino acids 7 to 171 (165 residues), 63.4 bits, see alignment E=1e-20 PF07993: NAD_binding_4" amino acids 46 to 169 (124 residues), 51.2 bits, see alignment E=4.1e-17

Best Hits

Swiss-Prot: 48% identical to YBJS_ECOLI: Uncharacterized protein YbjS (ybjS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 56% identity to ctu:CTU_24920)

Predicted SEED Role

"FIG036672: Nucleoside-diphosphate-sugar epimerase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>ABZR87_RS17835 NAD(P)-dependent oxidoreductase (Ralstonia sp. UNC404CL21Col)
MTTLVTGATGGLGRNAVDALLAHGAGVRATGRDAAQREAFIARGADYVPADLARLTPATL
DALLDGVDTVWHCAALSSPWGAYEDFYAANVRATAALAEAAVKRGIRRFVHISTPSIYFD
YQHHADLPESYRPARFANHYAATKMLAEAAIQQQVATQHRTHFVILRPRGLFGPHDRVVL
PRILHLLELRGGVLPLPRGGAARMDLTYLENVVHAMQCATSADVPSGAAYNITNHAPATL
RDLLDQLLGQQLGLRYRIRAVPYPAMALAARVMEAGSAVTHREPLLTRYSAAALHYDMTL
ANDRARIELGYVPPIDMAEGIRRTAHWLREHGNVVRF