Protein Info for ABZR87_RS17820 in Ralstonia sp. UNC404CL21Col

Annotation: phosphatase PAP2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 149 to 165 (17 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 49% identity to spe:Spro_2865)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>ABZR87_RS17820 phosphatase PAP2 family protein (Ralstonia sp. UNC404CL21Col)
MSPLATRLRHMALGWCSVGLVYGLCGALQGVGTVVPETALDRAIPFSTSGIWLYVSFFVL
IPLAYLRADVSRLPWLERAMQMSALVSGAVFMLWPTTLHYPPLADASLPGSVQRMLIAMD
SSQNCLPSLHGALTLLSVWALADSRKPMRTALAAAWGLGILYATIQTRRHVALDLSAGVA
VGVLCGAAVRLWLARRASTLSIEPVST