Protein Info for ABZR87_RS17785 in Ralstonia sp. UNC404CL21Col

Annotation: AEC family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 39 to 56 (18 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 123 to 146 (24 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details amino acids 280 to 305 (26 residues), see Phobius details PF03547: Mem_trans" amino acids 5 to 297 (293 residues), 43.7 bits, see alignment E=1.4e-15 PF01758: SBF" amino acids 195 to 304 (110 residues), 29 bits, see alignment E=8.1e-11

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 72% identity to rsc:RCFBP_20392)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>ABZR87_RS17785 AEC family transporter (Ralstonia sp. UNC404CL21Col)
MTAAILLALAPVALLVALGHWLKRSAFIAETFWPQAERLCYYVLLPSLFMHGLATAHMQA
LPVLPLVLTLMGATLLVAVALMLARPWMQVDGAAFTSVFQGAVRFNNYVGVSLATGLFGA
KGIALAAVCNAAIVPTVNLLCVLVFARYGSVRLTGRALVRQIVTNPPVVACSLGIAMQLL
GLQTPAAIEPAVRALGLASMPLGLLCVGAALNFSGVRSWAQPVIVSSIIKFLAMPVLTLA
LGHALGLTDAALIVALLFQALPTASSSYIMARQLGGDAPLMAGITAAQTVMAAAAMPAVM
TLLALTRGLPQGLLSAL