Protein Info for ABZR87_RS17755 in Ralstonia sp. UNC404CL21Col

Annotation: methionine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 77 to 101 (25 residues), see Phobius details amino acids 139 to 164 (26 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 35 to 201 (167 residues), 85.8 bits, see alignment E=1.6e-28

Best Hits

Swiss-Prot: 49% identical to METI_SALTI: D-methionine transport system permease protein MetI (metI) from Salmonella typhi

KEGG orthology group: K02072, D-methionine transport system permease protein (inferred from 86% identity to rme:Rmet_3857)

MetaCyc: 48% identical to L-methionine/D-methionine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter permease protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>ABZR87_RS17755 methionine ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MLEKYLRAFGETLLMVSSACLVVFVVGLALAIVLTTSAPGGLRSRPRLHRVLSVLVNTFR
SIPFIILLVAMLPVTRLIVGTTMGTWAAVVPLSAHLIPFFARVSQVGLNEVDRGLVEAAR
AMGCRRWHIVRHVLLPEALPALIGGATVTVIAMIGASAMAGAVGAGGLGDLAIRYGYERY
ETAVMFNVIAILIVLVTAVQLGGERLARQFDHRG