Protein Info for ABZR87_RS17720 in Ralstonia sp. UNC404CL21Col

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 51 to 69 (19 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 124 to 283 (160 residues), 54.2 bits, see alignment E=7.7e-19

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 99% identity to rpf:Rpic12D_4123)

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>ABZR87_RS17720 ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MQTETLSMPAATDISNRAPVYSTPVAFERIGVVEKPLSIAERLYEQAWLRKLVILVVLAL
VWEGGARWLDNPLLLPTFSDTVQALWAGLASGTLFARIGTSMQTLLAGYALGLALSCALV
VLGISNRLGQDFLETLTAMFNPLPAIALLPIALVWFGLGNGSLIFVIVHSVVWAVSLNTH
AGFLSVSNTLRMVGRNYGLSGMGYLTKILIPAAFPSILTGLKIGWAFAWRTLIASELVFG
VSSGQGGLGWYIYENKNQLQIPEVFAGLLTVIIIGLLVENLVFRTLEARTVKRWGMQN