Protein Info for ABZR87_RS17605 in Ralstonia sp. UNC404CL21Col

Annotation: AcvB/VirJ family lysyl-phosphatidylglycerol hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 587 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details PF06057: VirJ" amino acids 394 to 580 (187 residues), 271.2 bits, see alignment E=5.4e-85 PF01083: Cutinase" amino acids 439 to 500 (62 residues), 26.8 bits, see alignment E=4.6e-10

Best Hits

KEGG orthology group: None (inferred from 94% identity to rpf:Rpic12D_4107)

Predicted SEED Role

"FIG00977539: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (587 amino acids)

>ABZR87_RS17605 AcvB/VirJ family lysyl-phosphatidylglycerol hydrolase (Ralstonia sp. UNC404CL21Col)
MSWQAPRTQEARHRGVLRKGLRWVGHVSAVGMALAMSSVIAADAPAAAKPAPAQGPVLVP
PVGMTGASGVVAVPPRGDMPPRLQMSGAAVTANKAANGGVLSLPVVAPATPAAAPGAVEF
VTHGRFRDVPVYKPKGEIRSVVLMLSGDLGWTPAASRMAESLAQQGALVAGLSTPALFAS
LEADPGDCAFPDGDLENFSRFLQAYEKVPGYYPPILVGDNEGGALAYAMIAQARPNIFAA
AMSMEFCPVLELRKPLCKGEGVHFSRRMSESRTTAKRVKPPENAGVVLLPATKLSAPWVA
LQSATPTSFARRSGPLCEARATQAFIDTISGAQSLVLPAAAQASSAPPVTAVEPFKSAFA
KLVAQRKPPPPPPPAAVSDLPIIEVPAQPGTSSELFAVLLSGDGGWAGLDKEVAAALSKS
GVPVVGIDSLRYFWTPRTPASAAADMDRLVRFYAARWKKQKALLIGYSQGADVLPFIVNR
LPAASREHVALAVMMGLGKRADFEFHMTNWVSSSASGLLILPEVQKLPAGIGMCIYGKEE
KDTNCPGLDPKQVQLVKLPGGHHFDGDYAKLARIILEGARVAGNAPR