Protein Info for ABZR87_RS17580 in Ralstonia sp. UNC404CL21Col

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 104 to 128 (25 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details amino acids 407 to 429 (23 residues), see Phobius details amino acids 436 to 454 (19 residues), see Phobius details PF13520: AA_permease_2" amino acids 23 to 432 (410 residues), 117.3 bits, see alignment E=8.8e-38 PF00324: AA_permease" amino acids 27 to 434 (408 residues), 320.1 bits, see alignment E=2.4e-99

Best Hits

Swiss-Prot: 37% identical to YTNA_BACSU: Uncharacterized amino acid permease YtnA (ytnA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 65% identity to bgf:BC1003_4452)

MetaCyc: 39% identical to phenylalanine:H+ symporter PheP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56

Predicted SEED Role

"Phenylalanine-specific permease" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>ABZR87_RS17580 amino acid permease (Ralstonia sp. UNC404CL21Col)
MTKATGSFEALAAREGGLQHRLSSAQLTMIAIGSAIGTGLFLGSGAAIQLAGPGVIASYA
IGAFIALLLMGCLAEMVVAHPTTGSFGAYAEHYVSPLAGFLVRYAYWAAVVFVIGAEVTA
VAVYMAYWFPGVPAWVWIVGFSAMLVWINASSVDVFGVAEYWCSMIKVVAIVAFLAVASY
AIYRAPDGGPIGFQNYVSAGGFLPHGWNGVWFGAVVSIFSFFGIELIAVAAGEAREPEAA
ATSAFRSTLFRLVFFYLCTLALMLAVVPWQQAGTGKSPFVRVMEILGIAGGAGVMNFVVL
TAALSSMNAQLYVSTRMLFSLARGGQAPQALGAVSQRGVPLRALVVSSSGAALAAVLSVV
LPGHSFLLMMSLAMFGALFTWFVIFVTHLRFRRAAEREGRALRFRMWGFPVLTTLGAIAM
AVIIVSTAWMLDFRMTLVVGVPFLVVLAVVFRWVRGRQ