Protein Info for ABZR87_RS17550 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details amino acids 339 to 361 (23 residues), see Phobius details amino acids 371 to 396 (26 residues), see Phobius details amino acids 403 to 425 (23 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 387 (360 residues), 135.6 bits, see alignment E=1e-43

Best Hits

KEGG orthology group: None (inferred from 97% identity to rpi:Rpic_3987)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>ABZR87_RS17550 MFS transporter (Ralstonia sp. UNC404CL21Col)
MQVTGGTGVTEIEQRTLRKVVWRLVPFLMVCYLLAFIDRGNVGMASLQMNHDLGLTARVF
GFGSSLFFVSYFFFEVPSNLALQRYGARIWIARIMITWGLVSAATALVSGPVSFYALRFL
LGAAEAGFFPGVLLYLSYWIPATHRARIVATFMVAIPAASFIGSPISAALLQMDGFAGLR
GWHWLFILEGIPTVLLGIACLRVLSDRPEEAKWLSNEERQWLTNTLAGEARGPKKVAQMP
LAKLFCNRYVLCLALVDVCASAAGSTLSVWQPQLLKSFGLTVMQTGLLNSVPYAVASVLM
VLWGRRSDRLKERRWHTAIPMLLIGLGLFGTSLSGSLVPTMVMLCAVLVGAYSFKGPFWA
LASGMLSNSAAAAGLATINAIANLIGGGLMVNVYGWVQQATGSYALALMPLAVLTLVSVT
TLLLLSRSTPEAQVLSKTETA