Protein Info for ABZR87_RS17545 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 333 to 351 (19 residues), see Phobius details amino acids 357 to 378 (22 residues), see Phobius details amino acids 389 to 410 (22 residues), see Phobius details amino acids 420 to 441 (22 residues), see Phobius details PF07690: MFS_1" amino acids 45 to 407 (363 residues), 145.6 bits, see alignment E=9.1e-47

Best Hits

KEGG orthology group: None (inferred from 98% identity to rpi:Rpic_3986)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>ABZR87_RS17545 MFS transporter (Ralstonia sp. UNC404CL21Col)
MSQTLSATTPAHGADARPAATLPDADYQASERTLAKAFRRILPFIFACYVISYLDRTNVG
FAALTMNKDIGLTAEQFGFGAGLFFIGYFLFEIPSNLIMQKVGARIWIARIMITWGIFSM
ATAFVVGPKSFAAARFLLGLAEAGFTPGIYLYFTHWFPGKWRAKVTAAFLVGIPVANMIG
SPISGALLELGGLHGLRSWQWLLLIEGLPAVLLGIACLFVLADRPEKATWLTEDEKAVLA
RRLAMEQRDIASKHGATLRDAMTNWRVFVLAFINFCGIVGSIGVGLWMPQIIKQFGVEHT
VVGWLTAIPYALGAVVMLWWARTANRAQNRVPYVAAALVVAAVALAASTALDAPALKLAA
LCVTVSGILAFQATFWAIPSTFLTGRAAAGGLALIVSVGNLGGFVGPSMVGAIKQYSQGF
TAPLLAVSAVLIIGALSIAWLGDPGADAGEAATR