Protein Info for ABZR87_RS17520 in Ralstonia sp. UNC404CL21Col

Annotation: GNAT family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 18 to 157 (140 residues), 67.1 bits, E=2.7e-22
• PF00583: Acetyltransf_1
  • amino acids 71 to 153 (83 residues), 29.3 bits, E=9.4e-11

Best Hits

KEGG orthology group: None (inferred from 80% identity to bpy:Bphyt_2204)

Predicted SEED Role

"Amino-acid acetyltransferase (EC 2.3.1.1)" (EC 2.3.1.1)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1

Protein Sequence (201 amino acids)

>ABZR87_RS17520 GNAT family protein (Ralstonia sp. UNC404CL21Col)
MSQPTPDLFQPTLVGQHVELRPLLAHHASDLVAAAADGALWNLKVTVVPGPETIDSYIAT
ALKGRDAGSVMPFVIVRRDTGRIVGSTRFWKIDRTNRKLEIGHTWLSASAQRSNINTEAK
SLLLTHAFETMHCVRVQFTTDELNEKSRAAILRIGAKQEGIVRHERIMPDGRKRNSVRFS
IIDTEWPEVKALLEAKLAPPR