Protein Info for ABZR87_RS17515 in Ralstonia sp. UNC404CL21Col

Annotation: voltage-gated chloride channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 147 to 172 (26 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 219 to 242 (24 residues), see Phobius details amino acids 254 to 276 (23 residues), see Phobius details amino acids 305 to 316 (12 residues), see Phobius details amino acids 321 to 329 (9 residues), see Phobius details amino acids 334 to 360 (27 residues), see Phobius details amino acids 378 to 398 (21 residues), see Phobius details PF00654: Voltage_CLC" amino acids 63 to 392 (330 residues), 237.9 bits, see alignment E=9.7e-75

Best Hits

KEGG orthology group: None (inferred from 95% identity to rpf:Rpic12D_4094)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>ABZR87_RS17515 voltage-gated chloride channel family protein (Ralstonia sp. UNC404CL21Col)
MKKMVTRSEPLLMFGYLLRWLSLGALVGMLAGLGSAVLLLALDWATDTRIAHPWLLWFLP
VAGLAVGLLYHYTGRAVEGGNNLLIDEIHDPKRVVPKRMAPLILLGTVVTHLFGGSAGRE
GTAVQMGGSFADYLTRLFSLAPADRRILLMAGISAGFASVFGTPLAGAVFGLEVLAIGRL
RYDAILPCFIAAIVGDLVPPLLGVHHTPYAIPFVPHLTPIAIGLVVVAGIVFGLAGMTFA
ALTHRLSRVLKHRIAFGPLRPVLGGSVVVAAALALGTDKYLGLGIPVIVDAFHTPLPAYD
FAGKAAFTIVTLASGFKGGEVTPLFYIGATLGNALGYVLPLPFPLLAGLGFVAVFAGAAN
TPIASTLMAMELFGPEVGTFAGIACVVSYLFSGHTGIYHAQRIGHAKRPSETEPAAQAPA
ESAGRS