Protein Info for ABZR87_RS17415 in Ralstonia sp. UNC404CL21Col

Annotation: UbiX family flavin prenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00421: polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylases
  • amino acids 13 to 193 (181 residues), 234.8 bits, E=3e-74
• PF02441: Flavoprotein
  • amino acids 13 to 181 (169 residues), 146.7 bits, E=2.4e-47

Best Hits

Swiss-Prot: 56% identical to UBIX_NEIMB: Flavin prenyltransferase UbiX (ubiX) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K03186, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiX [EC: 4.1.1.-] (inferred from 78% identity to pfo:Pfl01_3431)

MetaCyc: 59% identical to flavin prenyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-16937 [EC: 2.5.1.129]

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase UbiX (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (11/12 steps found)
• superpathway of chorismate metabolism (44/59 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (7/8 steps found)
• prenylated FMNH₂ biosynthesis (1/3 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Fluorene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Purine metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 2.5.1.129 or 4.1.1.-

Protein Sequence (213 amino acids)

>ABZR87_RS17415 UbiX family flavin prenyltransferase (Ralstonia sp. UNC404CL21Col)
MSGRHLRPPAPPRMVVGISGASGFIYGVRLLELLRALDVETHLVVTRSAVLTMTHETPFK
LADVMARATHTHRADDMAAGIASGSFRALGMIVAPCSMKTLAEIATGVSSTLLTRAADVT
LKERRPLVLMARETPFTLAHLRNMQAVTEMGAIVAPPVPAFYARPNTLDDMIDHTLGRVL
DLFGLDAGTALRWGEEALPALVRTPPTLDKETA