Protein Info for ABZR87_RS17375 in Ralstonia sp. UNC404CL21Col

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 768 transmembrane" amino acids 183 to 205 (23 residues), see Phobius details amino acids 225 to 248 (24 residues), see Phobius details amino acids 300 to 324 (25 residues), see Phobius details amino acids 330 to 349 (20 residues), see Phobius details amino acids 411 to 436 (26 residues), see Phobius details amino acids 442 to 460 (19 residues), see Phobius details PF00664: ABC_membrane" amino acids 185 to 458 (274 residues), 152.2 bits, see alignment E=2.4e-48 PF00005: ABC_tran" amino acids 524 to 672 (149 residues), 114.6 bits, see alignment E=5.8e-37

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 97% identity to rpi:Rpic_3967)

Predicted SEED Role

"ABC transporter, transmembrane region:ABC transporter related"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (768 amino acids)

>ABZR87_RS17375 ABC transporter ATP-binding protein (Ralstonia sp. UNC404CL21Col)
MTQSSPSSAPIVASAQEPWSVVLAPSLAPEETVLAGLQLDLDARLHFTRGWLVVTNRRLV
GQAPGEKDLQSWDIAPGMTLAHSDHAGVGTLELSDGQRRLASWRYTLGRNTDALRLADAF
DAQRNALATGAQAAQPDAEVCPTCKAPLPPGEDNCPQCSRELEQPPSTWALLRLWRFARP
YRWELLAGFALLLIGTAATLVPPYLTMPLMDKVLIPYQNGQPVDYRLVTLYLSGLFGAAL
VAWVLGWARTYLLARVSERISADLRTTTYEHLLKLSLEYFGGKRTGDLMARIGSESDRIS
VFLSLHLLDFATDVLMIAMTAVILVSIDPWLALVTLVPLPFIAWMIHLVRDRLRHGFEKI
DRIWSEITNVLADTIPGIRVVKAFAQEKREVTRFAEANKHNLAINDRVNAVWSLFTPTVT
LLTEVGLLVVWIFGIWQVSHDAITVGVLVAFLTYISRFYTRLDSMSRIVSVTQKAAAGAK
RIFDILDHVSSVPEPAKPVHIEKVNGAIELRDLGFRYGNRAVIRGLNLSIQPGEMIGLVG
HSGSGKSTLVNLICRFYDVSEGAIRLDGTDIRSLPVSEFRRNIGLVLQEPFLFFGTIADN
IAYGKPDATREEIIAAARAAHAHEFILRLPHGYDSLVGERGQALSGGERQRISIARALLI
NPRILIMDEATSSVDTTTEKEIQKALDNLVQGRTTIAIAHRLSTLRKADRLVVMDRGQIV
EVGNHDELLAREGAYYKLYQAQARNVDADTDLTSDGERVDAAAPAYAQ