Protein Info for ABZR87_RS17255 in Ralstonia sp. UNC404CL21Col

Annotation: CynX/NimT family MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 102 to 119 (18 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 231 to 254 (24 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 297 to 315 (19 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details amino acids 386 to 406 (21 residues), see Phobius details PF07690: MFS_1" amino acids 52 to 366 (315 residues), 107.2 bits, see alignment E=4.5e-35

Best Hits

KEGG orthology group: K03449, MFS transporter, CP family, cyanate transporter (inferred from 69% identity to pau:PA14_32330)

Predicted SEED Role

"Cyanate transport protein CynX" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>ABZR87_RS17255 CynX/NimT family MFS transporter (Ralstonia sp. UNC404CL21Col)
MAGTSSVSDVAAQGTAADASPQAAAPSMRADAGWLGVVVVVALGMNLRPILTTIGPLLAE
IRAGTGLGLQGASLLTVIPVLCMGSVALFLPWLARWLPEHRGVACSLLAIAGACVWRLWA
GHGAALIASAALAGTGVAIVQALVPGLVKRWFPQRVPMALGLYSASLMAGGGIAATLSPR
ITHIADWHVGLGVWALPALAAFVLWTTARPRDAAAPAQRGPVLNFFGNRRAWLLAIYFGA
ANGGYTSMIAWLPMFYRQLGWSAQDAGSLIGLMTIFQVIGALAAPLLARRWPDRRPWLAI
VLVLQLIGMVGLLLAPQTGTTLWVALIGGGLGSMFSLCLTLTLDHLPDARAAGYLAAFVQ
GIGFIITGIIPYAVGWLRELTGGFQLPWALLIAIVIASMVTTLRFAPSGYARAIGPV